PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_101250_scro.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 25090.8 Da    PI: 9.914
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_101250_scro.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.89e-31959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien+s rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Bv5_101250_scro.t1  9 KRIENDSSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPSGKLYEFAS 59
                        79***********************************************86 PP

2K-box61.53.4e-2184173998
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                         l++++  + + +   L+k++++L+ ++R+llG++Le +s+ eLq+Le+qL+ksl++iR++Kn l++eqi++l + ek l +en +L+ k+
  Bv5_101250_scro.t1  84 LDQKNLLQFKDDTIELEKKLKSLELSKRKLLGDGLEACSIDELQELEKQLDKSLSSIRARKNALYKEQINKLYEEEKHLIKENVRLKDKV 173
                         566667777888889***********************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.861161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-33374IPR002100Transcription factor, MADS-box
CDDcd002654.55E-42372No hitNo description
PRINTSPR004041.4E-30323IPR002100Transcription factor, MADS-box
PfamPF003195.2E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-2189173IPR002487Transcription factor, K-box
PROSITE profilePS5129712.37689179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MVRGKTQMKR IENDSSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP SGKLYEFASS  60
STTKTIDRYQ KHMKDLRGVK SKVLDQKNLL QFKDDTIELE KKLKSLELSK RKLLGDGLEA  120
CSIDELQELE KQLDKSLSSI RARKNALYKE QINKLYEEEK HLIKENVRLK DKVLNSSPDL  180
LRRQQRADDQ EISMQDVETE LFIGPPESRN NTRYLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A8e-20372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B8e-20372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C8e-20372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D8e-20372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A9e-20372271Myocyte-specific enhancer factor 2A
3kov_B9e-20372271Myocyte-specific enhancer factor 2A
3kov_I9e-20372271Myocyte-specific enhancer factor 2A
3kov_J9e-20372271Myocyte-specific enhancer factor 2A
3mu6_A6e-20372271Myocyte-specific enhancer factor 2A
3mu6_B6e-20372271Myocyte-specific enhancer factor 2A
3mu6_C6e-20372271Myocyte-specific enhancer factor 2A
3mu6_D6e-20372271Myocyte-specific enhancer factor 2A
3p57_A9e-20372271Myocyte-specific enhancer factor 2A
3p57_B9e-20372271Myocyte-specific enhancer factor 2A
3p57_C9e-20372271Myocyte-specific enhancer factor 2A
3p57_D9e-20372271Myocyte-specific enhancer factor 2A
3p57_I9e-20372271Myocyte-specific enhancer factor 2A
3p57_J9e-20372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818955e-41LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132635e-41LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010676581.11e-155PREDICTED: agamous-like MADS-box protein AGL19
SwissprotO827434e-79AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBLA0A0J8CJD01e-155A0A0J8CJD0_BETVU; Uncharacterized protein
STRINGfgenesh2_kg.7__2003__AT4G22950.14e-78(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.12e-70AGAMOUS-like 19